Structure of PDB 5li0 Chain Z Binding Site BS02

Receptor Information
>5li0 Chain Z (length=82) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR
GGDDTLFAKIDGVVKFERKGRDKKQVSVYAVA
Ligand information
>5li0 Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc
.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><....<<...<.<............>.>....>>
...>..>..>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R79 K80 G81 R82
Binding residue
(residue number reindexed from 1)		R68 K69 G70 R71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum5li0
PubMed27906650
UniProtQ2FXT0|RL27_STAA8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]