Structure of PDB 2c9l Chain Z Binding Site BS02

Receptor Information
>2c9l Chain Z (length=62) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPS
LDVDSIIPRTPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c9l Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R179 N182 R183 R187 R190 K194
Binding residue
(residue number reindexed from 1)		R5 N8 R9 R13 R16 K20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2c9l, PDBe:2c9l, PDBj:2c9l
PDBsum2c9l
PubMed16483937
UniProtP03206|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]