Structure of PDB 5it7 Chain YY Binding Site BS02

Receptor Information
>5it7 Chain YY (length=125) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQSLDVSSDRRKARKAYFTAPSSERRVLLSAPLSKELREQYNIKALPIRK
EDEVLVVRGSKKGQEGKVSSVYRLKFAVQVDKLTKEKSNGASVPTNIHPS
KVVITKLHLDKDRKALIQRKGGKLE
Ligand information
>5it7 Chain 8 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaauugcgauauguauugugaauugcagauuuucgugaaucaucaaaucu
uugaacgcacauugcgcccucugguauuccagggggcaugccuguuugag
cgucauu
.........................................<<<<<<<((
....>>>>.....<..<<......))..............>>...>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R13 R16 K17 F20 P23 S24 S25 R28 R51 K52 S72 V73 Y74 R75 L111 D112 K113 D114 K116 R121
Binding residue
(residue number reindexed from 1)		R11 R14 K15 F18 P21 S22 S23 R26 R49 K50 S70 V71 Y72 R73 L109 D110 K111 D112 K114 R119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5it7, PDBe:5it7, PDBj:5it7
PDBsum5it7
PubMed27159451
UniProtQ6CW97

[Back to BioLiP]