Structure of PDB 4p6f Chain YS Binding Site BS02

Receptor Information

>4p6f Chain YS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>4p6f Chain YB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4p6f Macrolide-Peptide Conjugates as Probes of the Path of Travel of the Nascent Peptides through the Ribosome.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): R15 K19 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 V46 T47 S50 L54 N61 K62 T63 Y92 H95 G96 R97
• Binding residue (residue number reindexed from 1): R14 K18 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 V45 T46 S49 L53 N60 K61 T62 Y91 H94 G95 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4p6f, PDBe:4p6f, PDBj:4p6f
• PDBsum: 4p6f
• PubMed: 25198768
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)