Structure of PDB 7pwo Chain Y2 Binding Site BS02

Receptor Information
>7pwo Chain Y2 (length=133) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLNSAVTASRRKCRKAYFTANAETRAKMMSSRLSKELRAEHKIKTMPIR
RGDIVEIFTGGHKGTGKVVEVRRRDYKICVEGINQKARNPEAKPVPYPIH
PSNCIIKELYMNGSRYRAIKRRQERNAERLARI
Ligand information
>7pwo Chain 42 (length=138) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcgg
cggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgaccc
ucgaacgcagcgcgcccggcgccgccgccucggcgccc
..........................................<<<<<<.(
(.....>>>.....<<<<<<...<..))..>.........>>>>>>...>
>>....<<...>><<...>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pwo Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		R12 R15 K16 F19 A23 E24 R50 R51 R73 R74 N112 G113 S114 Y116 R117 R121
Binding residue
(residue number reindexed from 1)		R12 R15 K16 F19 A23 E24 R50 R51 R73 R74 N112 G113 S114 Y116 R117 R121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pwo, PDBe:7pwo, PDBj:7pwo
PDBsum7pwo
PubMed35100413
UniProtA8BFT3

[Back to BioLiP]