Structure of PDB 8eui Chain Y Binding Site BS02

Receptor Information
>8eui Chain Y (length=125) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVR
RDDQITVIRGSNKGREGKITSVYRKKFLLLIERVTREKANGASAPVGIDA
SKVVITKLHLDKDRKDLIVRKGGKV
Ligand information
>8eui Chain 2 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaauc
uuugaacgcacauugcgccuuuggguucuaccaaaggcaugccuguuuga
gugucauu
..........................................<<<<<<.<
<.....>>>.....(.<<<......>>..............>>>..)...
>>>....<<.....>><<<<<<<<......>>>>>>>>............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eui Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 R51 V72 Y73 R74 K75 H109 D113 R120
Binding residue
(residue number reindexed from 1)		R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 R51 V72 Y73 R74 K75 H109 D113 R120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eui, PDBe:8eui, PDBj:8eui
PDBsum8eui
PubMed36423630
UniProtP78946|RL26_SCHPO Large ribosomal subunit protein uL24 (Gene Name=rpl26)

[Back to BioLiP]