Structure of PDB 8etj Chain Y Binding Site BS02

Receptor Information

>8etj Chain Y (length=125) Species: 4896 (Schizosaccharomyces pombe)

MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVR
RDDQITVIRGSNKGREGKITSVYRKKFLLLIERVTREKANGASAPVGIDA
SKVVITKLHLDKDRKDLIVRKGGKV

Ligand information

>8etj Chain 2 (length=144)

aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacgcgccuuugggaccaaaggcaugccuguuugagugucau

..........................................<<<<<<<<
<....>>>>.....<.<<<......>>........>>>..>...>>>...
.<<..>><<<<<<<<..>>>>>>>>...................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8etj Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R11 R12 R15 K16 F19 S23 S24 R27 R50 R51 V72 Y73 K75 D113
• Binding residue (residue number reindexed from 1): R11 R12 R15 K16 F19 S23 S24 R27 R50 R51 V72 Y73 K75 D113

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8etj, PDBe:8etj, PDBj:8etj
• PDBsum: 8etj
• PubMed: 36423630
• UniProt: P78946|RL26_SCHPO Large ribosomal subunit protein uL24 (Gene Name=rpl26)