Structure of PDB 8ch6 Chain Y Binding Site BS02

Receptor Information

>8ch6 Chain Y (length=306) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PEIHNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADD
PDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVPAQYIRYTPSQKQR
VIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEW
KIPPCISNWKVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEK
EKHEEKLREMAQKARERRARDEIRHDRRKERQHDRNLSRAAPDKRSKLQR
NENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNV
YDQAWR

Ligand information

>8ch6 Chain g (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucggccuccgaacgguaagagccuagcauguagaacugguuaugauguca
uacuuauccugucccuuuuuuuucca

..................................................
..........................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ch6 Structural basis of catalytic activation in human splicing.
Resolution	5.9 Å
Binding residue (original residue number in PDB)	H365 N368 L369
Binding residue (residue number reindexed from 1)	H233 N236 L237

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003713	transcription coactivator activity
GO:0003714	transcription corepressor activity
GO:0003723	RNA binding
GO:0005112	Notch binding
GO:0005515	protein binding
GO:0016922	nuclear receptor binding
GO:0019899	enzyme binding
GO:0042809	nuclear vitamin D receptor binding
GO:0042974	nuclear retinoic acid receptor binding
GO:0046332	SMAD binding
GO:0050681	nuclear androgen receptor binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0000398	mRNA splicing, via spliceosome
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043923	positive regulation by host of viral transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0048026	positive regulation of mRNA splicing, via spliceosome
GO:0048384	retinoic acid receptor signaling pathway
GO:0048385	regulation of retinoic acid receptor signaling pathway
GO:0050769	positive regulation of neurogenesis
GO:0070562	regulation of vitamin D receptor signaling pathway
GO:0070564	positive regulation of vitamin D receptor signaling pathway
GO:0071300	cellular response to retinoic acid

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0008024	cyclin/CDK positive transcription elongation factor complex
GO:0016363	nuclear matrix
GO:0016604	nuclear body
GO:0016607	nuclear speck
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071013	catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ch6, PDBe:8ch6, PDBj:8ch6
PDBsum	8ch6
PubMed	37165190
UniProt	Q13573\|SNW1_HUMAN SNW domain-containing protein 1 (Gene Name=SNW1)

[Back to BioLiP]