Structure of PDB 7uvz Chain Y Binding Site BS02

Receptor Information
>7uvz Chain Y (length=57) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTIKVTQTKSSSHRLKNHKLCLQGLGLRRIGHTVEVQDTPSNRGMINKVY
YMVSVEE
Ligand information
>7uvz Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uvz Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		H19 Y51 Y52
Binding residue
(residue number reindexed from 1)		H18 Y50 Y51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvz, PDBe:7uvz, PDBj:7uvz
PDBsum7uvz
PubMed37192172
UniProtB7IA21|RL30_ACIB5 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]