Structure of PDB 6fy3 Chain Y Binding Site BS02

Receptor Information
>6fy3 Chain Y (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFMLTQPHSVSESPGKTVTISCTRSSGSIASDYVQWYQQRPGSSPTTVIY
EDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDMTNHN
WVFGGGTKLTVLGQPKAAPSVTLFPATLVCLISDFYPGAVTVAWKADSSP
VKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEK
TV
Ligand information
>6fy3 Chain P (length=15) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKKQKAYALFYRPD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fy3 Common helical V1V2 conformations of HIV-1 Envelope expose the alpha 4 beta 7 binding site on intact virions.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S22 T24 S26 G28 S67 S68 N69
Binding residue
(residue number reindexed from 1)		S21 T23 S25 G27 S70 S71 N72
External links