Structure of PDB 5me1 Chain Y Binding Site BS02

Receptor Information
>5me1 Chain Y (length=76) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNA
KPPVCRIMDYGKFRFEQQKKEKEARK
Ligand information
>5me1 Chain X (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcaacca
..<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5me1 Structure of a 30S pre-initiation complex stalled by GE81112 reveals structural parallels in bacterial and eukaryotic protein synthesis initiation pathways.
Resolution13.5 Å
Binding residue
(original residue number in PDB)		N51 K53
Binding residue
(residue number reindexed from 1)		N49 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0032790 ribosome disassembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5me1, PDBe:5me1, PDBj:5me1
PDBsum5me1
PubMed27986852
UniProtP03000|IF3_GEOSE Translation initiation factor IF-3 (Gene Name=infC)

[Back to BioLiP]