Structure of PDB 5me0 Chain Y Binding Site BS02

Receptor Information
>5me0 Chain Y (length=76) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNA
KPPVCRIMDYGKFRFEQQKKEKEARK
Ligand information
>5me0 Chain X (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcaacca
..<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5me0 Structure of a 30S pre-initiation complex stalled by GE81112 reveals structural parallels in bacterial and eukaryotic protein synthesis initiation pathways.
Resolution13.5 Å
Binding residue
(original residue number in PDB)		V48 A49 N51 A52 K72 E73 R77
Binding residue
(residue number reindexed from 1)		V46 A47 N49 A50 K70 E71 R75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0032790 ribosome disassembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5me0, PDBe:5me0, PDBj:5me0
PDBsum5me0
PubMed27986852
UniProtP03000|IF3_GEOSE Translation initiation factor IF-3 (Gene Name=infC)

[Back to BioLiP]