Structure of PDB 4d5y Chain Y Binding Site BS02

Receptor Information

>4d5y Chain Y (length=127) Species: 9986 (Oryctolagus cuniculus)

MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIR
KDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
PSKVVITRLKLDKDRKKILERKAKSRQ

Ligand information

>4d5y Chain 3 (length=157)

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcuu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>.............>>>..)...>>
>....<<<..>>><<<<<<<<<.....>>>>>>>>>..............
.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4d5y Cryo-Em Structures of Ribosomal 80S Complexes with Termination Factors and Cricket Paralysis Virus Ires Reveal the Ires in the Translocated State
• Resolution: 9.0 Å
• Binding residue (original residue number in PDB): R15 K16 F19 P22 S23 H24 R27 R50 K51 Q72 Y74 R75 K76 L111 D112 K113 D114 R115 K116 I118
• Binding residue (residue number reindexed from 1): R15 K16 F19 P22 S23 H24 R27 R50 K51 Q72 Y74 R75 K76 L111 D112 K113 D114 R115 K116 I118

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 2 03:35:33 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4d5y', asym_id = 'Y', bs = 'BS02', title = 'Cryo-Em Structures of Ribosomal 80S Complexes wi...s Ires Reveal the Ires in the Translocated State '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4d5y', asym_id='Y', bs='BS02', title='Cryo-Em Structures of Ribosomal 80S Complexes wi...s Ires Reveal the Ires in the Translocated State ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4d5y', asym_id = 'Y'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015934', uniprot='', pdbid='4d5y', asym_id='Y')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>