Structure of PDB 6oxi Chain XY Binding Site BS02

Receptor Information
>6oxi Chain XY (length=84) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKH
NLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oxi Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
Resolution3.495 Å
Binding residue
(original residue number in PDB)		E46 L48 K49 N51 R65 H83 Y84
Binding residue
(residue number reindexed from 1)		E46 L48 K49 N51 R65 H83 Y84
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006401 RNA catabolic process
GO:0098795 global gene silencing by mRNA cleavage

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6oxi, PDBe:6oxi, PDBj:6oxi
PDBsum6oxi
PubMed31501867
UniProtJ7QFC0

[Back to BioLiP]