Structure of PDB 6otr Chain XY Binding Site BS02

Receptor Information
>6otr Chain XY (length=84) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKH
NLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6otr Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
Resolution3.12 Å
Binding residue
(original residue number in PDB)		H50 N51
Binding residue
(residue number reindexed from 1)		H50 N51
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006401 RNA catabolic process
GO:0098795 global gene silencing by mRNA cleavage

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6otr, PDBe:6otr, PDBj:6otr
PDBsum6otr
PubMed31501867
UniProtJ7QFC0

[Back to BioLiP]