Structure of PDB 4yzv Chain XY Binding Site BS02

Receptor Information
>4yzv Chain XY (length=91) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIKSFKHKGLKLLFEKGVTSGVPAQDVDRINDRLQAIDTATEIGELNRQI
YKLHPLKGDREGYWSITVRANWRITFQFINGDAYILNYEDY
Ligand information
>4yzv Chain XV (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yzv Defining the mRNA recognition signature of a bacterial toxin protein.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		G58 D59
Binding residue
(residue number reindexed from 1)		G58 D59
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0030371 translation repressor activity
GO:0043022 ribosome binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006401 RNA catabolic process
GO:0008285 negative regulation of cell population proliferation
GO:0017148 negative regulation of translation
GO:0030308 negative regulation of cell growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4yzv, PDBe:4yzv, PDBj:4yzv
PDBsum4yzv
PubMed26508639
UniProtQ7A225|HIGB_PROVU Endoribonuclease HigB (Gene Name=higB)

[Back to BioLiP]