Structure of PDB 4w4g Chain XY Binding Site BS02

Receptor Information
>4w4g Chain XY (length=92) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIKSFKHKGLKLLFEKGVTSGVPAQDVDRINDRLQAIDTATEIGELNRQI
YKLHPLKGDREGYWSITVRANWRITFQFINGDAYILNYEDYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4w4g Defining the mRNA recognition signature of a bacterial toxin protein.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		H54 L56 K57 G58 R73 Y91
Binding residue
(residue number reindexed from 1)		H54 L56 K57 G58 R73 Y91
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0030371 translation repressor activity
GO:0043022 ribosome binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006401 RNA catabolic process
GO:0008285 negative regulation of cell population proliferation
GO:0017148 negative regulation of translation
GO:0030308 negative regulation of cell growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4w4g, PDBe:4w4g, PDBj:4w4g
PDBsum4w4g
PubMed26508639
UniProtQ7A225|HIGB_PROVU Endoribonuclease HigB (Gene Name=higB)

[Back to BioLiP]