Structure of PDB 6buw Chain XM Binding Site BS02

Receptor Information
>6buw Chain XM (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGK
Ligand information
>6buw Chain XV (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6buw Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
T116 A118
Binding residue
(residue number reindexed from 1)
T115 A117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6buw, PDBe:6buw, PDBj:6buw
PDBsum6buw
PubMed30476222
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]