Structure of PDB 7a5k Chain X3 Binding Site BS02

Receptor Information

>7a5k Chain X3 (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFK
INPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRL
KKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKASGE
DLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEA
EWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALS

Ligand information

>7a5k Chain FE (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauuaacacca

<<<<<<<...................<............>........<.
.........>..>>>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7a5k Elongational stalling activates mitoribosome-associated quality control.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	D95 K96 L97
Binding residue (residue number reindexed from 1)	D94 K95 L96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005829	cytosol
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7a5k, PDBe:7a5k, PDBj:7a5k
PDBsum	7a5k
PubMed	33243891
UniProt	Q13084\|RM28_HUMAN Large ribosomal subunit protein bL28m (Gene Name=MRPL28)

[Back to BioLiP]