Structure of PDB 7a5g Chain X3 Binding Site BS02

Receptor Information
>7a5g Chain X3 (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFK
INPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRL
KKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKASGE
DLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEA
EWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALS
Ligand information
>7a5g Chain C (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauuaacacca
<<<<<<<.................<................>........
............>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a5g Elongational stalling activates mitoribosome-associated quality control.
Resolution4.33 Å
Binding residue
(original residue number in PDB)		Y91 A92 N93 N94 D95 K96 S98 K99
Binding residue
(residue number reindexed from 1)		Y90 A91 N92 N93 D94 K95 S97 K98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5g, PDBe:7a5g, PDBj:7a5g
PDBsum7a5g
PubMed33243891
UniProtQ13084|RM28_HUMAN Large ribosomal subunit protein bL28m (Gene Name=MRPL28)

[Back to BioLiP]