Structure of PDB 8y6o Chain X Binding Site BS02

Receptor Information

>8y6o Chain X (length=131) Species: 9606 (Homo sapiens)

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDG
EVMPVVVVQSATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHLTS
AGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQ

Ligand information

>8y6o Chain P (length=124)

aaaaagggcuucugucgugaguggcacacguagggcaacauugcucugcg
ugcggaaucgacaucaagagauuucggaagcauaauuuuuugguauuugg
gcagcuggugauucccggcgcccu

.......<<<<.<<<<......>>>><<<<<<<<<<<<..>>>>>>>>>>
>><<<<<<<..........>>>>>>>.>>>>.................<<
<<.<<<<<.<<.>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8y6o Structural basis of U12-type intron engagement by the fully assembled human minor spliceosome
• Resolution: 3.38 Å
• Binding residue (original residue number in PDB): K68 G83 I84 H86 I87 S88 S90 Y91 R109 L129 R130
• Binding residue (residue number reindexed from 1): K68 G83 I84 H86 I87 S88 S90 Y91 R109 L129 R130

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005689 U12-type spliceosomal complex
• GO:0005829 cytosol
• GO:0045171 intercellular bridge

External links

• PDB: RCSB:8y6o, PDBe:8y6o, PDBj:8y6o
• PDBsum: 8y6o
• PubMed: 38484052
• UniProt: Q9BV90|SNR25_HUMAN U11/U12 small nuclear ribonucleoprotein 25 kDa protein (Gene Name=SNRNP25)