Structure of PDB 8i0w Chain X Binding Site BS02

Receptor Information
>8i0w Chain X (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERARE
EMQRYAEDVGAVKKKEEKLDW
Ligand information
>8i0w Chain H (length=139) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuuua
auauguccucuaccgaggacaauauuaaggauuuuuggagcagggagcca
cgcaucgaccugguauugcaguaccuccaggaacggugc
...............................................<<<
<<<<<<<<<<....>>>>>>.>>>>>>>...............<......
><<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0w Molecular basis for the activation of human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)		L8 K9 T16 L17
Binding residue
(residue number reindexed from 1)		L7 K8 T15 L16
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071006 U2-type catalytic step 1 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
PDBsum8i0w
PubMed39068178
UniProtQ9NXE8|CWC25_HUMAN Pre-mRNA-splicing factor CWC25 homolog (Gene Name=CWC25)

[Back to BioLiP]