Structure of PDB 8fn2 Chain X Binding Site BS02

Receptor Information

>8fn2 Chain X (length=181) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENSRVLSCQYRSSFGSSNARRIRAKSEIPAVVYGQGKDVSHLRIKSSEFN
KKFAKFTDNTVLILDDGKLERCVFVKDAAENIASKLIYHIDFYEVDRNVE
LEKYVPIKLIGASIGVKEGGILTVLKEQVKVRSLPLDLPEFIELDLTPVN
KGDSVLLKDLVLPSNVRLAENDENLEVVIIK

Ligand information

>8fn2 Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccuggugguuaaagaaaagaggaaacaccuguuaucauuccgaacacag
aaguuaagcucuuauucgcugaugguacugcgaguucgcgggagaguagg
uuauugccaggg

<<<<<<<<<.....<<.<<<<<.....<<<<<<.............>>>>
..>>....>>>>>..>><<<.....<.<<<<<....>>>>>...>...>>
>..>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8fn2 The structure of a hibernating ribosome in a Lyme disease pathogen.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	F15 G16 S17 S18 R22 R24 Y34 V40 H42 H90 D92
Binding residue (residue number reindexed from 1)	F14 G15 S16 S17 R21 R23 Y33 V39 H41 H89 D91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fn2, PDBe:8fn2, PDBj:8fn2
PDBsum	8fn2
PubMed	37907464
UniProt	O51727\|RL25_BORBU Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]