Structure of PDB 8azw Chain X Binding Site BS02

Receptor Information
>8azw Chain X (length=50) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHKTFMIKKKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF
Ligand information
>8azw Chain B (length=163) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacgacucucggcaacggauaucucggcucucgcaucgaugaagaacgu
agcgaaaugcgauacuuggugugaauugcagaauuccgugaaccaucgag
ucuuugaacgcaaguugcgcccgaagccauuaggccgagggcacgucugc
cugggcgucacgc
............................................<<<<<<
.((.....>>>....<<<<<<<.....))............>.>>>>.>>
..>>>....<<.....>><<<<...<<......>>...>>>>........
.............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		T6 F7 K12 K15 R18 Q19 R21 I23 P24 W26 M29 R30 T31 K40
Binding residue
(residue number reindexed from 1)		T5 F6 K11 K14 R17 Q18 R20 I22 P23 W25 M28 R29 T30 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum8azw
PubMed37156858
UniProtA0A1S3YR32

[Back to BioLiP]