Structure of PDB 7unr Chain X Binding Site BS02

Receptor Information

>7unr Chain X (length=190) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DFILNAQVRSDLGKGASRRLRRNAGLVPAVVYGGDKEPQSVTLELREIAK
LLENEAAFSHVIALNVGGAKETVLIKALQRHPAKGFVMHADFLRVVADHK
LTAHVPLHFINEEVAVGVKQAGGEISHTISEVEVSCLPKDLPEFIEVDMA
KVELGQIVHLSDLKAPKGVELVQLAHGNDLAVANIHASRV

Ligand information

>7unr Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcuugacgaucauagagcguuggaaccaccugaucccuucccgaacucag
aagugaaacgacgcaucgccgaugguaguguggggucuccccaugugaga
guaggucaucgucaagc

<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>>
..>>>...>>>>>>.>><<<.......<<<<<<<<...>>>>>>>>....
...>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Resolution	2.9 Å
Binding residue (original residue number in PDB)	R11 K16 R21 R23 R24 V32 Y34 Q81 H91 H101 H178
Binding residue (residue number reindexed from 1)	R9 K14 R19 R21 R22 V30 Y32 Q79 H89 H99 H176

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum	7unr
PubMed
UniProt	Q9HVC4\|RL25_PSEAE Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]