Structure of PDB 7r72 Chain X Binding Site BS02

Receptor Information
>7r72 Chain X (length=98) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKALKVRTSATFRLPRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKA
NKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANR
Ligand information
>7r72 Chain 2 (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaacgcgcgauacucuuugaacgcacauugcgccccuugguauuccaggg
ggcaagcgu
<<<<<..>>......>>>....<<.....>><<<<<<<<<....>>>>>>
>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r72 Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution3.07 Å
Binding residue
(original residue number in PDB)		K22 L24 F32 R56 K61 K89 Y93 Q94
Binding residue
(residue number reindexed from 1)		K2 L4 F12 R16 K21 K49 Y53 Q54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r72, PDBe:7r72, PDBj:7r72
PDBsum7r72
PubMed36482249
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]