Structure of PDB 6dzp Chain X Binding Site BS02

Receptor Information
>6dzp Chain X (length=79) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDD
TLFALAPGAVEFGAKRGRKTVNIVPVARP
Ligand information
>6dzp Chain B (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuacggcgguccauagcggcagggaaacgcccggucccaucccgaaccc
ggaagcuaagccugccagcgccgaugauacuacccauccggguggaaaag
uaggacaccgccgaacac
<<<.<<<<<<<.....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.....
..>>..>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dzp Zinc depletion induces ribosome hibernation in mycobacteria.
Resolution3.42 Å
Binding residue
(original residue number in PDB)		A71 K72 G74
Binding residue
(residue number reindexed from 1)		A64 K65 G67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dzp, PDBe:6dzp, PDBj:6dzp
PDBsum6dzp
PubMed30038002
UniProtA0R150|RL27_MYCS2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]