Structure of PDB 5zwm Chain X Binding Site BS02

Receptor Information
>5zwm Chain X (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKIQQINDKELQSGILSPHQSWHNEYKDNAYIYIGNLNRELTEGDILTVF
SEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRA
LKIDHTFYRPKRSLQKYYEAVKEELDRD
Ligand information
>5zwm Chain Z (length=22) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSQYIDIMPDFSPSGLLELESN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zwm Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
Resolution3.4 Å
Binding residue
(original residue number in PDB)		T43 D46 T49 R64 G98 K117 Y118 A121 E125
Binding residue
(residue number reindexed from 1)		T42 D45 T48 R63 G97 K116 Y117 A120 E124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0051237 maintenance of RNA location
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0070274 RES complex
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zwm, PDBe:5zwm, PDBj:5zwm
PDBsum5zwm
PubMed29794219
UniProtP40565|IST3_YEAST U2 snRNP component IST3 (Gene Name=IST3)

[Back to BioLiP]