Structure of PDB 5lmt Chain X Binding Site BS02

Receptor Information
>5lmt Chain X (length=164) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEYLTNERIRAKQVRVVGPDGKQLGIMDTREALRLAQEMDLDLVLVGPNA
DPPVARIMDYSKWRYEQQMAEKEARKTEVKSIKFRVKIDEHDYQTKLGHI
KRFLQEGHKVKVTIMFRGREVAHPELGERILNRVTEDLKDLAVVEMKPEM
LGRDMNMLLAPVKV
Ligand information
>5lmt Chain Z (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lmt Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
Resolution4.15 Å
Binding residue
(original residue number in PDB)		Y5 V19 D22 G23 K24 Q25 R58 R77 K117 E151 M152 D160
Binding residue
(residue number reindexed from 1)		Y3 V17 D20 G21 K22 Q23 R56 R75 K111 E145 M146 D154
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0032790 ribosome disassembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lmt, PDBe:5lmt, PDBj:5lmt
PDBsum5lmt
PubMed27662086
UniProtQ5SKU2|IF3_THET8 Translation initiation factor IF-3 (Gene Name=infC)

[Back to BioLiP]