Structure of PDB 3q0c Chain X Binding Site BS02

Receptor Information
>3q0c Chain X (length=147) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIV
SSGGYNDVLDNSDVLIYTGQGGNVGEPPKDQQLVTGNLALKNSINKKNPV
RVIRGIKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q0c A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
Resolution2.6567 Å
Binding residue
(original residue number in PDB)		N383 R389 S391 Q392 Y397
Binding residue
(residue number reindexed from 1)		N22 R28 S30 Q31 Y36
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.
External links
PDB RCSB:3q0c, PDBe:3q0c, PDBj:3q0c
PDBsum3q0c
PubMed21245167
UniProtO82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 (Gene Name=SUVH5)

[Back to BioLiP]