Structure of PDB 3jct Chain X Binding Site BS02

Receptor Information
>3jct Chain X (length=141) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAV
PHYNRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKE
LYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI
Ligand information
>3jct Chain 2 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
Resolution3.08 Å
Binding residue
(original residue number in PDB)		T18 N19 K22 T37 L38 R42 S48 K49 H53 Y54 N55 R56 K61 K89 Y93
Binding residue
(residue number reindexed from 1)		T17 N18 K21 T36 L37 R41 S47 K48 H52 Y53 N54 R55 K60 K88 Y92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum3jct
PubMed27251291
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]