Structure of PDB 3jcs Chain X Binding Site BS02

Receptor Information
>3jcs Chain X (length=64) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPR
FIPWTRTYRRIHRK
Ligand information
>3jcs Chain 5 (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uacgucccucuccaaacgagagaacaugcaugggcuggcaugagcggccu
ugaggccugaaauuucaugcuagggacaca
...<<<<<<<<<.......>>>>....<<<<<<<..<<<......<..>.
....>>>......>>>>>>>..>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R37 K39 P54 W55 R60
Binding residue
(residue number reindexed from 1)		R36 K38 P53 W54 R59
External links