Structure of PDB 8rt7 Chain W Binding Site BS02

Receptor Information
>8rt7 Chain W (length=246) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAM
YELAFRYPDTQARQTREANARAAVEAAFEQRVGAYYNLKYMMSGDKDIAP
VNAWDDGRFTYFKFSANADLPSIYFVDAEGNESLVPRTTVGSSNNIIAVH
KVNPKWMIRLGNRALAIFNEAYDPNGVPNDTGTASPAVRRVNKGGN
Ligand information
>8rt7 Chain u (length=19) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTPYELARERMLRSGLTAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rt7 Cryo-EM structure of a conjugative type IV secretion system suggests a molecular switch regulating pilus biogenesis.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		L50 A76 F85 K87 Q89 A90 E91 R116
Binding residue
(residue number reindexed from 1)		L30 A56 F65 K67 Q69 A70 E71 R96
External links