Structure of PDB 8b4b Chain W Binding Site BS02

Receptor Information
>8b4b Chain W (length=110) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVIS
RNDLHDFVWREQGFEVDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGY
QLIARVETVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b4b ToxR activates the Vibrio cholerae virulence genes by tethering DNA to the membrane through versatile binding to multiple sites.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		W64 V71
Binding residue
(residue number reindexed from 1)		W59 V66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8b4b, PDBe:8b4b, PDBj:8b4b
PDBsum8b4b
PubMed37428913
UniProtP15795|TOXR_VIBCH Cholera toxin transcriptional activator (Gene Name=toxR)

[Back to BioLiP]