Structure of PDB 7msm Chain W Binding Site BS02

Receptor Information
>7msm Chain W (length=74) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDT
LFAKTAGAVEFGIKRGRKTVSIVG
Ligand information
>7msm Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca
<<.<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.......
>>...>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7msm Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		K72 R73
Binding residue
(residue number reindexed from 1)		K64 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msm, PDBe:7msm, PDBj:7msm
PDBsum7msm
PubMed35064151
UniProtP9WHB3|RL27_MYCTU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]