Structure of PDB 7ko5 Chain W Binding Site BS02

Receptor Information
>7ko5 Chain W (length=274) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATAL
QKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR
KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ
AEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDEL
YAQKLKYKAISEELDHALNDMTSI
Ligand information
>7ko5 Chain Z (length=29) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDAIKKKMQMLKLDKENALDRAEQAEADK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ko5 The structure of the native cardiac thin filament at systolic Ca 2+ levels.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		L278 T282 I284
Binding residue
(residue number reindexed from 1)		L268 T272 I274
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046982 protein heterodimerization activity
GO:0051015 actin filament binding
Biological Process
GO:0007015 actin filament organization
GO:0060048 cardiac muscle contraction
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ko5, PDBe:7ko5, PDBj:7ko5
PDBsum7ko5
PubMed33753506
UniProtP42639|TPM1_PIG Tropomyosin alpha-1 chain (Gene Name=TPM1)

[Back to BioLiP]