Structure of PDB 6mzm Chain W Binding Site BS02

Receptor Information
>6mzm Chain W (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMDTENVVV
CQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Ligand information
>6mzm Chain V (length=80) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agggcgcctataaaagggggtgggggcgcgttcgtcctcagtcgcgatcg
aacactcgagccgagcagacgtgcctacgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mzm Structure of human TFIID and mechanism of TBP loading onto promoter DNA.
Resolution7.5 Å
Binding residue
(original residue number in PDB)		H343 K350
Binding residue
(residue number reindexed from 1)		H57 K64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter
Cellular Component
GO:0005672 transcription factor TFIIA complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mzm, PDBe:6mzm, PDBj:6mzm
PDBsum6mzm
PubMed30442764
UniProtP52655|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 (Gene Name=GTF2A1)

[Back to BioLiP]