Structure of PDB 6f42 Chain W Binding Site BS02

Receptor Information
>6f42 Chain W (length=165) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CKPNFPIGQISENFEKSKMAKKAKLEKRRHLRELRMRARQEKVDENPFAN
LYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQV
KAKFVNEEKKRPILIELALRSKLPPNFDEYCCEIKKNIGTVADFNEKLIE
LQNEHKHHMKEIEEA
Ligand information
>6f42 Chain Y (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
actattgcgaaaaaaacatttatttatagtagccgaaaatagt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f42 Molecular mechanism of promoter opening by RNA polymerase III.
Resolution5.5 Å
Binding residue
(original residue number in PDB)		K306 R307 R311 N407 Y408 G409 Y416 K452 K455
Binding residue
(residue number reindexed from 1)		K27 R28 R32 N53 Y54 G55 Y62 K98 K101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001156 TFIIIC-class transcription factor complex binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006355 regulation of DNA-templated transcription
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6f42, PDBe:6f42, PDBj:6f42
PDBsum6f42
PubMed29345638
UniProtP46678|TFC5_YEAST Transcription factor TFIIIB component B'' (Gene Name=BDP1)

[Back to BioLiP]