Structure of PDB 5umd Chain W Binding Site BS02

Receptor Information

>5umd Chain W (length=170) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YAKKIRNLGKCAKGAGVDLRVHFKNTYEAARAIRRMKLLEAKKYLNDVIE
KKRCVPFRKYNGGVGRTNQAKEFNHTQGRWPAKSCKFLLNILDNVQANAE
SRNLDVSKLRLIHVMVNKARPGRRRTYKAHGRINPFMSSPCHIQIIAREI
NISNQNRLKNKSVKKQQTVQ

Ligand information

>5umd Chain C (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a

............................................<<<<<<
.((.....>>>.....<.<<<<..<<.)).>>.......>>>>..>...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	A5 K40 R61 K62 R113 N120 K121 R123 H145
Binding residue (residue number reindexed from 1)	A2 K37 R58 K59 R110 N117 K118 R120 H142

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum	5umd
PubMed	28288098
UniProt	Q8IDI5

[Back to BioLiP]