Structure of PDB 4wf9 Chain W Binding Site BS02

Receptor Information
>4wf9 Chain W (length=58) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKV
KHLVTVEE
Ligand information
>4wf9 Chain Y (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc
.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><....<....<.<............>.>.....>
...>..>..>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wf9 Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
Resolution3.427 Å
Binding residue
(original residue number in PDB)		Q19 H52
Binding residue
(residue number reindexed from 1)		Q19 H52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wf9, PDBe:4wf9, PDBj:4wf9
PDBsum4wf9
PubMed26464510
UniProtP0A0G2|RL30_STAA8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]