Structure of PDB 2qkk Chain W Binding Site BS02

Receptor Information
>2qkk Chain W (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMGDFVVVYTDGCCSSRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEI
HAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKE
VINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution3.2 Å
Binding residue
(original residue number in PDB)
T181 N182 W221 W225 T232 S233 V238 I239 N240
Binding residue
(residue number reindexed from 1)
T44 N45 W84 W88 T95 S96 V101 I102 N103
Enzymatic activity
Catalytic site (original residue number in PDB) D145 G146 E186 N210 H264 D274
Catalytic site (residue number reindexed from 1) D11 G12 E49 N73 H127 D137
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum2qkk
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]