Structure of PDB 1vq5 Chain W Binding Site BS02

Receptor Information
>1vq5 Chain W (length=154) Species: 2238 (Haloarcula marismortui) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVND
FVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFAL
LSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLL
EAMR
Ligand information
>1vq5 Chain 9 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccggggaguacuggagugcgcgagccucug
ggaaacccgguucgccgccacc
...<<<<<<....<<<<<<<<......<<<<<...............>>>
..>>....>>>>>>.>><..<<<<<.....<<<<<<.<<....>>>>>>>
>....>>>>>.>.>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vq5 Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R8 H14 N49 D50 K129 H130 P131 K133 E134
Binding residue
(residue number reindexed from 1)
R8 H14 N49 D50 K129 H130 P131 K133 E134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1vq5, PDBe:1vq5, PDBj:1vq5
PDBsum1vq5
PubMed16285925
UniProtP14121|RL30_HALMA Large ribosomal subunit protein uL30 (Gene Name=rpl30)

[Back to BioLiP]