Structure of PDB 7xvm Chain V Binding Site BS02

Receptor Information
>7xvm Chain V (length=84) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQI
KLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAK
Ligand information
>7xvm Chain T (length=169) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcttttttttttcacaatcccggtgccgaggccgctcaattggtcgtaga
cagctctagcaccgcttaaacgcacgtacggattccgtacgtgcgtttaa
gcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggatt
gtgaaaaaaaaaagctgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xvm Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169a DNA fragment)
Resolution2.84 Å
Binding residue
(original residue number in PDB)		S47 Q49 K83 T85 K86 S93 R95 K101 A102
Binding residue
(residue number reindexed from 1)		S28 Q30 K64 T66 K67 S74 R76 K82 A83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xvm, PDBe:7xvm, PDBj:7xvm
PDBsum7xvm
PubMed
UniProtP02259|H5_CHICK Histone H5

[Back to BioLiP]