Structure of PDB 7msh Chain V Binding Site BS02

Receptor Information

>7msh Chain V (length=177) Species: 83332 (Mycobacterium tuberculosis H37Rv)

SNQLRVTVRTETGKGASRRARRAGKIPAVLYGHGAEPQHLELPGHDYAAV
LRHSGTNAVLTLDIAGKEQLALTKALHIHPIRRTIQHADLLVVRRGEKVV
VEVSVVVEGQAGPDTLVTQETNSIEIEAEALSIPEQLTVSIEGAEPGTQL
TAGQIALPAGVSLISDPDLLVVNVVKA

Ligand information

>7msh Chain B (length=115)

uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca

...<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.......
>>...>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7msh Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
• Resolution: 3.23 Å
• Binding residue (original residue number in PDB): R14 T17 G18 K19 S22 R23 V34 Y36 G37 H44 H92
• Binding residue (residue number reindexed from 1): R9 T12 G13 K14 S17 R18 V29 Y31 G32 H39 H87

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7msh, PDBe:7msh, PDBj:7msh
• PDBsum: 7msh
• PubMed: 35064151
• UniProt: P9WHB5|RL25_MYCTU Large ribosomal subunit protein bL25 (Gene Name=rplY)