Structure of PDB 6spf Chain V Binding Site BS02

Receptor Information

>6spf Chain V (length=188) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FIVNAQVRSDLGKGASRRLRRNAGLVPAVVYGGDKEPQSVTLELREIAKL
LENEAAFSHVIALNVGGVKETVLIKALQRHPAKGFVMHADFLRVVADHKL
TAHVPLHFINEEVAVGVKQAGGEISHTISEVEVSCLPKDLPEFIEVDMAK
VELGQIVHLSDLKAPKGVELVQLAHGNDLAVANIHASR

Ligand information

>6spf Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcuugacgaucauagagcguuggaaccaccugaucccuucccgaacucag
aagugaaacgacgcaucgccgaugguaguguggggucuccccaugugaga
guaggucaucgucaagc

<<<<<<<<<<....<<<<<<<.....<<<<<<...............>>>
..>>>....>>>>>.>><<<.......<<<<<<<<...>>>>>>>>....
...>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6spf Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.
Resolution	2.89 Å
Binding residue (original residue number in PDB)	R11 L14 G15 K16 S19 R20 R21 R23 R24 V32 Y34 P40 H91 H178
Binding residue (residue number reindexed from 1)	R8 L11 G12 K13 S16 R17 R18 R20 R21 V29 Y31 P37 H88 H175

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6spf, PDBe:6spf, PDBj:6spf
PDBsum	6spf
PubMed	31611393
UniProt	A0A072ZBM5

[Back to BioLiP]