Structure of PDB 6ppf Chain V Binding Site BS02

Receptor Information
>6ppf Chain V (length=73) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFA
KIDGTVKFERFGRDRKKVSVYPV
Ligand information
>6ppf Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<..........<<<<<...>>>>>..........
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R79 G81
Binding residue
(residue number reindexed from 1)		R60 G62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
PDBsum6ppf
PubMed31665744
UniProtP05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]