Structure of PDB 6f40 Chain V Binding Site BS02

Receptor Information
>6f40 Chain V (length=337) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSELESREATLNNA
RRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVA
CRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSLFIQ
HFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACR
MNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDG
EARPPSFVKNRKKECPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAH
LLNEEASKLKERIWIGLNADFLLEQESKRLKQEADIA
Ligand information
>6f40 Chain Y (length=57) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaatgtccacgaagggttactgaaaaaaacatttatttatagtagccgaa
aatagtg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f40 Molecular mechanism of promoter opening by RNA polymerase III.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R120 R219 A251 E253 T254 R258
Binding residue
(residue number reindexed from 1)		R87 R186 A218 E220 T221 R225
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000994 RNA polymerase III core binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001156 TFIIIC-class transcription factor complex binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006352 DNA-templated transcription initiation
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070897 transcription preinitiation complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6f40, PDBe:6f40, PDBj:6f40
PDBsum6f40
PubMed29345638
UniProtP29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit (Gene Name=BRF1)

[Back to BioLiP]