Structure of PDB 5v7q Chain V Binding Site BS02

Receptor Information

>5v7q Chain V (length=177) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SNQLRVTVRTETGKGASRRARRAGKIPAVLYGHGAEPQHLELPGHDYAAV
LRHSGTNAVLTLDIAGKEQLALTKALHIHPIRRTIQHADLLVVRRGEKVV
VEVSVVVEGQAGPDTLVTQETNSIEIEAEALSIPEQLTVSIEGAEPGTQL
TAGQIALPAGVSLISDPDLLVVNVVKA

Ligand information

>5v7q Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca

.<.<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<........<<<<<....>>>>>........
>>...>>>>>>.>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	K19 R23 R24 R26 V34 H92
Binding residue (residue number reindexed from 1)	K14 R18 R19 R21 V29 H87

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum	5v7q
PubMed	28977617
UniProt	P9WHB5\|RL25_MYCTU Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]