Structure of PDB 5ui5 Chain V Binding Site BS02

Receptor Information

>5ui5 Chain V (length=323) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVE
ELEKVRQKVLRLEPLGVCSKDVWEFLELQIEEIYPEEEEILKKALRDLKR
GKKLKPEIKGKLSRLRLFPLSAEKVYTFAKVDAIIEEENGEFFIYLYEDF
IDIDLNEEYWELYKKSRNLQKELKEAFERYESIRKVLDIRRRNLRKVLEK
IVERQKDFLTGKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGTY
SLRTFFVRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGF
KVARRTVAKYREMLGIPSSRERR

Ligand information

>5ui5 Chain O (length=30) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctatttattgcaattttcgtgccaatttcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ui5 Crystal structure of Aquifex aeolicus sigma (N) bound to promoter DNA and the structure of sigma (N)-holoenzyme.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	S306 S334 R379 T380 Y384 R394
Binding residue (residue number reindexed from 1)	S232 S260 R305 T306 Y310 R320
Binding affinity	PDBbind-CN: Kd=103nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001216	DNA-binding transcription activator activity
GO:0003677	DNA binding
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5ui5, PDBe:5ui5, PDBj:5ui5
PDBsum	5ui5
PubMed	28223493
UniProt	O66858

[Back to BioLiP]