Structure of PDB 5oql Chain V Binding Site BS02

Receptor Information
>5oql Chain V (length=121) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAAWPKAEDPALVQELLDCVQQASHYRQLKKGANETTKSVNRGTSELVIL
AADTQPLSIVLHIPLICEEKNVPYVYVPSKVALGRACGVSRAVIAVSLTS
NEASDLNSKIRALRDKVERLA
Ligand information
>5oql Chain 2 (length=230) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgacaauacuucagagaaucauuucuauaguaguuguccucucuugug
uuuccuaaaggagccacagaucccacccggguugaugaacgagauccucg
gcgccagugagguccauuuacucucgcucuaccugcaaagguggcggucg
cgugccucgucucgcggcuguauagagaguggcgaugaucuguaccccgc
ggggugggugucgauggaagucugaccggc
..................................................
..........................<<<<..............<<<<<<
<<<<.<<............<<<<<<...<<<<<<....>>>>>><<<<<<
<<.<......>.>>>>>>>>....>>>>>>.........>>.<<<<<<..
>>>>>>.>>>>>>>.>>>.......>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oql 3.2- angstrom -resolution structure of the 90S preribosome before A1 pre-rRNA cleavage.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K36 G37 A38 N39 E40 K43 Q60 I64 K85 V94 R96 A97 V98 I99
Binding residue
(residue number reindexed from 1)		K31 G32 A33 N34 E35 K38 Q55 I59 K80 V89 R91 A92 V93 I94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000470 maturation of LSU-rRNA
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oql, PDBe:5oql, PDBj:5oql
PDBsum5oql
PubMed28967883
UniProtG0SGM0

[Back to BioLiP]